PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G347400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MIKC_MADS
Protein Properties Length: 226aa    MW: 25608.4 Da    PI: 10.2142
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G347400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF931.4e-29959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien + rqvtfskRrng+lKKA+ELSvLCdaev +i+fs++gklye++s
  Sevir.9G347400.1.p  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIVFSPRGKLYEFAS 59
                        79***********************************************86 PP

2K-box65.61.8e-2279171698
               K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                         +++  +++ ++ + ++  L +++e L++++R++lGe+Le +s++eL++Le +Leksl  iR kK++ll  qi +l++ke+ l ++nk+Lr+
  Sevir.9G347400.1.p  79 NNKSVQQDIQQVKADALSLANRLEALEKSKRKFLGENLEGCSVEELHSLEVKLEKSLHVIRGKKTQLLELQIAKLKEKERTLLKDNKELRE 169
                         445678889*********************************************************************************9 PP

               K-box  97 kl 98 
                         k 
  Sevir.9G347400.1.p 170 KQ 171
                         85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.623161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-40160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-32385IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-31323IPR002100Transcription factor, MADS-box
CDDcd002653.68E-41374No hitNo description
PfamPF003191.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-2384170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.91587177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MVRGKTEMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVGLIVFSP RGKLYEFASA  60
SSLQKTIDRY KAYTRENVNN KSVQQDIQQV KADALSLANR LEALEKSKRK FLGENLEGCS  120
VEELHSLEVK LEKSLHVIRG KKTQLLELQI AKLKEKERTL LKDNKELREK QRNVQPQPVA  180
PALNPRCLPP WPRNLPAPCN DNADVETELY IGLPGRERTS NRDSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A7e-17373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B7e-17373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C7e-17373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D7e-17373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A7e-17373271Myocyte-specific enhancer factor 2A
3kov_B7e-17373271Myocyte-specific enhancer factor 2A
3kov_I7e-17373271Myocyte-specific enhancer factor 2A
3kov_J7e-17373271Myocyte-specific enhancer factor 2A
3p57_A7e-17373271Myocyte-specific enhancer factor 2A
3p57_B7e-17373271Myocyte-specific enhancer factor 2A
3p57_C7e-17373271Myocyte-specific enhancer factor 2A
3p57_D7e-17373271Myocyte-specific enhancer factor 2A
3p57_I7e-17373271Myocyte-specific enhancer factor 2A
3p57_J7e-17373271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983814.11e-163PREDICTED: MADS-box transcription factor 56-like
SwissprotA2Z9Q71e-113MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLC0P9541e-137C0P954_MAIZE; MADS transcription factor
STRINGSb01g030570.11e-141(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.11e-69AGAMOUS-like 19